LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human TNFRSF1A / TNFR1 Protein (Recombinant) - LS-G27178

Catalog Size Price
LS-G27178-10 10 µg Unavailable
LS-G27178-50 50 µg Unavailable

Most Popular TNFRSF1A / TNFR1 Proteins

Human TNFRSF1A / TNFR1 Protein (Recombinant) - LS-G336
E. coli Expression System
162 AA
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Human TNFRSF1A / TNFR1 Protein (Recombinant His) - LS-G1954
E. coli Expression System
186 AA
His
Purified
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Human TNFRSF1A / TNFR1 Protein (Recombinant Human IgG1 Fc) (aa22-211) - LS-G3915
Human HEK 293 Cells
Human IgG1 Fc
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.01 EU/µg protein (determined by LAL method).
Mouse TNFRSF1A / TNFR1 Protein (Recombinant His) (aa239-433) - LS-G13936
E. coli Expression System
His
Purified / Lyophilized
Mouse TNFRSF1A / TNFR1 Protein (Recombinant) (Ile22-Ala212) - LS-G39741
E. coli Expression System
192 AA
None
Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).

100% Guaranteed
LS-G27178
Recombinant Protein
TNFRSF1A / TNFR1
Human
28~35 kDa (SDS-PAGE)
TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-a or TNF-ß to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-?B, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyer’s patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli.
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
CHO Cells
Hamster-Chinese
None
Greater than 95% by SDS-PAGE
ED50 < 50 ng/ml, measured in a cell proliferation assay using 929 cells in the presence of 1 ng/ml human TNF-a.
Less than 0.2 EU/µg protein (determined by LAL method).
Lyophilized from PBS.
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 1 week or at -20°c for up to 2 months.
For research use only.

About TNFRSF1A / TNFR1

P19438 NM_001065 NP_001056.1

TNFRSF1A Protein, CD120a Protein, CD120a antigen Protein, MS5 Protein, p60 Protein, TBP1 Protein, TNF-R55 Protein, TNFAR Protein, TNFR1 Protein, p55-R Protein, TNF-R Protein, TNF-R-I Protein, TNF-R1 Protein, TNF-RI Protein, Tnfr Protein, TNFR-I Protein, TNFR1-d2 Protein, TNFR60 Protein, FPF Protein, p55 Protein, Tbpi Protein, TNFR55 Protein

TNFRSF1A / TNFR1 is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor.

Requested From: 
Date Requested: 6/22/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number