LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human TGFB1 / TGF Beta 1 Protein (Recombinant) - LS-G23621

Catalog
Size
Price
LS-G23621-5
5 µg
$215
LS-G23621-20
20 µg
$365
LS-G23621-100
100 µg
$1,110
LS-G23621-500
500 µg
$3,360
LS-G23621-1
1 mg
$5,610
Description
TGFB1 / TGF Beta 1 Protein LS-G23621 is Recombinant Human TGFB1 / TGF Beta 1 in Hamster-Chinese It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Type
Recombinant Protein
Target
TGFB1 / TGF Beta 1
Species
Human
Predicted Molecular Weight
25.6 kDa
Details
Transforming Growth Factor beta 1 comes as a dimer having a 112/224 amino acid chain. Transforming growth factor-beta 1 (TGF-b1) is a member of the TGF-beta superfamily of cytokines. Members of this family exhibit regulatory activity in immunity, proliferation, adhesion, migration, and growth inhibition pathways. TGF-b1 signals through SMAD proteins via the TGF-bRI and TGF-bRII receptors.
AA Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
Determined by Inhibition of IL-4-induced HT-2 Cell Proliferation; <= 500 pg/ml; >= 2.0x10^6 units/mg; 3600 RU/ug
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1 % trifluoroacetic acid (TFA) and Trehalose in a 20:1 Trehalose to protein ratio
Reconstitution
Reconstitute in sterile 10 mM HCl at a concentration of 0.1 mg/ml.
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only.
About TGFB1 / TGF Beta 1
P01137 NM_000660 NP_000651.3

Popular TGFB1 / TGF Beta 1 Proteins

Recombinant Transforming Growth Factor Beta 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Protein
Source: Human Human Cells
Tag: None
Format: Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Recombinant Transforming Growth Factor Beta 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His, N-Terminal
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Inhibition

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Inhibition

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Inhibition

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Inhibition


Requested From: United States
Date Requested: 7/19/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy