LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human TGFB1 / TGF Beta 1 Protein (Recombinant) - LS-G135674

Catalog
Size
Price
LS-G135674-2
2 µg
$195
LS-G135674-10
10 µg
$255
LS-G135674-100
100 µg
$1,350
Description
Human TGFB1 / TGF Beta 1 Protein (Recombinant) - LS-G135674
Type
Recombinant Protein
Target
TGFB1 / TGF Beta 1
Species
Human
Predicted Molecular Weight
25.6kDa
Details
TGFB1 Human Recombinant produced in CHO cells is a glycosylated homodimeric polypeptide chain containing 2 x 112 amino acids and having a total molecular mass of 25.6kDa. The TGFB1 is purified by proprietary chromatographic techniques.
Region
2 x 112 AA
AA Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 95% by SDS-PAGE
Bio-Activity
The ED50 as determined by the dose-dependent inhibition of IL-4-induced proliferation of HT-2 cells is 45.9pg/ml, corresponding to a specific activity of 2.2x107units/mg.
Endotoxin
Not Tested
Presentation
Lyophilized from 0.2 um sterile-filtered solution containing 0.1% trifluoroacetic acid (TFA) and trehalose (in a 20:1 trehalose to protein ratio).
Reconstitution
Reconstitute the lyophilized product in sterile 10mM HCL at a concentration of 0.1 mg/ml, which can then be further diluted to other aqueous solutions.
Storage
Store at room temperature for 3 weeks, store desiccated below -18°C. Upon reconstitution store at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze-thaw cycles.
Usage Summary
Product for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Restrictions
For research use only.
About TGFB1 / TGF Beta 1
P01137 NM_000660 NP_000651.3

Popular TGFB1 / TGF Beta 1 Proteins

Inhibition Image
Source: Hamster-Chinese CHO Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Recombinant Transforming Growth Factor Beta 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Protein
Source: Human Human Cells
Tag: None
Format: Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Recombinant Transforming Growth Factor Beta 1 By SDS-PAGE
Source: E. coli Expression System
Tag: His, N-Terminal
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 5/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy