Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21772-20 20 µg $307 
LS-G21772-100 100 µg $400 
LS-G21772-1 1 mg $1,152 
SKAP1 / SCAP1 Protein

Human SKAP1 / SCAP1 Protein (Recombinant His-SUMO) (aa1-358) - LS-G21772

Human SKAP1 / SCAP1 Protein (Recombinant His-SUMO) (aa1-358) - LS-G21772

Description:
SKAP1 / SCAP1 Protein LS-G21772 is a Recombinant Human SKAP1 / SCAP1 produced in E. coli aa 1-358 with His-SUMO tag(s).
Price
Catalog Number
$307
LS-G21772-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
SKAP1 / SCAP1 Protein LS-G21772 is a Recombinant Human SKAP1 / SCAP1 produced in E. coli aa 1-358 with His-SUMO tag(s).

Specifications

Type
Recombinant Protein
Target
SKAP1 / SCAP1
Synonyms
SKAP1 | Pp55 | SKAP55 | SKAP-55 | SCAP1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-SUMO
Region
aa 1-358
Predicted Molecular Weight
57.3 kD
AA Sequence
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About SKAP1 / SCAP1
Q86WV1 NM_003726 Q86WV1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SKAP1 / SCAP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SKAP1 / SCAP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SKAP1 / SCAP1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SKAP1 / SCAP1 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/16/2021