Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21171-20 20 µg $311 
LS-G21171-100 100 µg $408 
LS-G21171-1 1 mg (1.44 mg/ml) $1,207 
Protein

Human SEPP1 / Selenoprotein P (Recombinant 6His, N-terminus) (aa20-381) - LS-G21171

Human SEPP1 / Selenoprotein P (Recombinant 6His, N-terminus) (aa20-381) - LS-G21171

Description:
SEPP1 / Selenoprotein P Protein LS-G21171 is a Recombinant Human SEPP1 / Selenoprotein P produced in E. coli aa 20-381 with 6His, N-terminus tag(s).
Price
Catalog Number
$311
LS-G21171-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
SEPP1 / Selenoprotein P Protein LS-G21171 is a Recombinant Human SEPP1 / Selenoprotein P produced in E. coli aa 20-381 with 6His, N-terminus tag(s).

Specifications

Type
Recombinant Protein
Target
SEPP1 / Selenoprotein P
Synonyms
SEPP1 | Selenoprotein P | SEP | Selenoprotein P, plasma, 1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
aa 20-381
Predicted Molecular Weight
44.7 kD
AA Sequence
ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Reconstitution
Briefly centrifuge vial prior to opening. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration).
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About SEPP1 / Selenoprotein P
P49908 NM_005410 NP_005401.3

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/28/2022