Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G33260-10 10 µg $479 
LS-G33260-25 25 µg $670 
SDCBP2 / Syntenin 2 Protein - 12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue

Human SDCBP2 / Syntenin 2 Protein (Recombinant GST) (Full Length) - LS-G33260

Human SDCBP2 / Syntenin 2 Protein (Recombinant GST) (Full Length) - LS-G33260

Available for shipment within the USA only
Description:
SDCBP2 / Syntenin 2 Protein LS-G33260 is a Recombinant Human SDCBP2 / Syntenin 2 produced in Wheat Germ Extract with GST tag(s). For Research Use Only
Price
Catalog Number
$479
LS-G33260-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
SDCBP2 / Syntenin 2 Protein LS-G33260 is a Recombinant Human SDCBP2 / Syntenin 2 produced in Wheat Germ Extract with GST tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
SDCBP2 / Syntenin 2
Synonyms
SDCBP2 | SITAC | Syndecan-binding protein 2 | ST-2 | Syntenin-2 | SITAC18
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST
Predicted Molecular Weight
57.86 kDa
AA Sequence
MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA
Expression System
Wheat Germ Extract
Source Species
Wheat
Purification
Glutathione Sepharose
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About SDCBP2 / Syntenin 2
Q9H190 NM_015685 NP_056500.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SDCBP2 / Syntenin 2 Protein - 12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue
12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SDCBP2 / Syntenin 2 Protein - 12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue
12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SDCBP2 / Syntenin 2 Protein - 12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue
12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

SDCBP2 / Syntenin 2 Protein - 12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue
12.5% SDS-PAGE of human SDCBP2 stained with Coomassie Blue

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/24/2024