Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G59102-10 10 µg $479 
LS-G59102-25 25 µg $670 
RPSA / Laminin Receptor Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.

Human RPSA / Laminin Receptor Protein (Recombinant GST, N-terminus) (aa196-295) - LS-G59102

Human RPSA / Laminin Receptor Protein (Recombinant GST, N-terminus) (aa196-295) - LS-G59102

Available for shipment within the USA only
Description:
RPSA / Laminin Receptor Protein LS-G59102 is a Recombinant Human RPSA / Laminin Receptor produced in Wheat Germ Extract aa 196-295 with GST, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$479
LS-G59102-10

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
RPSA / Laminin Receptor Protein LS-G59102 is a Recombinant Human RPSA / Laminin Receptor produced in Wheat Germ Extract aa 196-295 with GST, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
RPSA / Laminin Receptor
Synonyms
RPSA | 37 kDa laminin receptor | 37LRP | 40S ribosomal protein SA | 67LR | 67 kDa laminin receptor | 37/67 kDa laminin receptor | 67kD, ribosomal protein SA | LAMR1 | LAMBR | Laminin receptor 1 | LamR | NEM/1CHD4 | SA | LRP/LR | Laminin binding protein | Laminin Receptor | LRP | p40 | Ribosomal protein SA
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST, N-terminus
Region
aa 196-295
AA Sequence
EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS
Expression System
Wheat Germ Extract
Source Species
Wheat
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About RPSA / Laminin Receptor
P08865 NM_002295 NP_002286.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPSA / Laminin Receptor Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPSA / Laminin Receptor Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPSA / Laminin Receptor Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPSA / Laminin Receptor Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/24/2024