LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
Human POMC / Proopiomelanocortin Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G75317
Catalog
Size
Price
LS-G75317-20
20 µg
$195
Description
Human POMC / Proopiomelanocortin Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G75317
Type
Over-Expression Lysate Protein
Target
POMC / Proopiomelanocortin
Species
Human
Predicted Molecular Weight
29.42 kDa Full Length
Details
This product includes lyophilized lysate of HEK293T cells that have been transiently-tranfected with Human ACTH(POMC) (NM_000939) and is intended for use as a Western blot positive control. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix and 1mM Na3VO4). See related products for a larger volume of this lysate supplied with a vector only control and 2x SDS-Page load buffer, or the purified form of this recombinant protein.
AA Sequence
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGGPEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKRELTGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE(CloningSiteandTags:myc-FLAG tag)
Expression System
293T Cells
Source Species
Human
Purification
Unpurified
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized
Reconstitution
Reconstitute with SDS Sample Buffer
Storage
Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About POMC / Proopiomelanocortin
P01189 NM_000939 NP_000930.1

Popular POMC / Proopiomelanocortin Proteins

Recombinant Proopiomelanocortin By SDS-PAGE
Source: E. coli Expression System
Tag: His + T7
Format: Purified / Lyophilized
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
AA Sequence Size: 262 AA
Tag: His
Format: Purified
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Tag: None
Format: Purified / Lyophilized
Recombinant Proopiomelanocortin By SDS-PAGE
Source: E. coli Expression System
Tag: His + GST
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/10/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy