• Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question?
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Contact Us

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human PLA2G10 Protein (Recombinant His) - LS-G17549

Catalog Size Price
LS-G17549-2 2 µg Unavailable
LS-G17549-10 10 µg Unavailable
LS-G17549-1 1 mg Unavailable

Most Popular PLA2G10 Proteins

Human PLA2G10 Protein (Recombinant His) - LS-G17549
E. coli Expression System
Purified / Lyophilized
Human PLA2G10 Protein (Recombinant His + T7) (aa32-165) - LS-G25375
E. coli Expression System
His + T7
Human PLA2G10 Protein (Recombinant GST) - LS-G31134
Wheat Wheat Germ Extract
165 AA
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Human PLA2G10 Protein (Recombinant) - LS-G44421
E. coli Expression System
Human PLA2G10 Protein (Recombinant GST,N-terminus) (aa64-165) - LS-G60709
Wheat Wheat Germ Extract
102 AA
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

100% Guaranteed
Recombinant Protein
Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
E. coli
E. coli
Greater than 95% by SDS-PAGE
Not Tested
Not Tested
Lyophilized from 0.01 M Tris, pH 7.2.
Store at -20°C lyophilized. Once reconstituted, aliquot to avoid freeze/thaw and store at -20°C.
For research use only.

About PLA2G10

O15496 NM_003561 NP_003552.1

PLA2G10 Protein, GX sPLA2 Protein, GXPLA2 Protein, GXSPLA2 Protein, Phospholipase A2, group X Protein, SPLA2 Protein, SPLA2-X Protein

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine.

Requested From: 
Date Requested: 3/18/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy

Catalog Number