LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human OSBPL3 Protein (Over-Expression Lysate Myc + DDK) (Full Length) - LS-G86883

Catalog
Size
Price
LS-G86883-20
20 µg
$195
Description
OSBPL3 Protein LS-G86883 is Over-Expression Lysate Human OSBPL3 in Human with Myc + DDK tag(s).
Type
Over-Expression Lysate Protein
Target
OSBPL3
Species
Human
Predicted Molecular Weight
101 kDa Full Length
Details
This product includes lyophilized lysate of HEK293T cells that have been transiently-tranfected with Human OSBPL3 (NM_015550) and is intended for use as a Western blot positive control. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix and 1mM Na3VO4). See related products for a larger volume of this lysate supplied with a vector only control and 2x SDS-Page load buffer, or the purified form of this recombinant protein.
AA Sequence
MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNLSNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNPVLGETYECIREDKGFQFFSEQVSHHPPISACHAESRNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSACVWRANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERRRVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW(CloningSiteandTags:myc-FLAG tag)
Expression System
293T Cells
Source Species
Human
Purification
Unpurified
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized
Reconstitution
Reconstitute with SDS Sample Buffer
Storage
Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
Usage Summary
Western blot: Spin down briefly and resuspend in 2X SDS Sample Buffer (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5 minutes.
Restrictions
For research use only.
About OSBPL3
Q9H4L5 NM_015550 NP_056365.1

Popular OSBPL3 Proteins

12.5% SDS-PAGE of human OSBPL3 stained with Coomassie Blue
Source: Wheat Wheat Germ Extract
Tag: GST
Format: Purified
12.5% SDS-PAGE Stained with Coomassie Blue.
Source: Wheat Wheat Germ Extract
Tag: GST,N-terminus
Purified recombinant protein OSBPL3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified
Purified recombinant protein OSBPL3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Source: Human HEK 293 Cells
Tag: Myc + DDK
Format: Purified

Publications (0)


Customer Reviews (0)


Images

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Requested From: United States
Date Requested: 5/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy