Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G3634-10 10 µg $281 
LS-G3634-50 50 µg $369 
Protein

Human NRG1 / Heregulin / Neuregulin Protein (Recombinant) - LS-G3634

Human NRG1 / Heregulin / Neuregulin Protein (Recombinant) - LS-G3634

Description:
NRG1 / Heregulin / Neuregulin Protein LS-G3634 is a Recombinant Human NRG1 / Heregulin / Neuregulin produced in E. coli aa177-241 of Q02297-6. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only
Price
Catalog Number
$281
LS-G3634-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
NRG1 / Heregulin / Neuregulin Protein LS-G3634 is a Recombinant Human NRG1 / Heregulin / Neuregulin produced in E. coli aa177-241 of Q02297-6. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only

Specifications

Type
Recombinant Protein
Target
NRG1 / Heregulin / Neuregulin
Synonyms
NRG1 | ARIA | GGF | GGF2 | Glial growth factor | Heregulin | HRGA | MSTP131 | NDF | Neu differentiation factor | Neuregulin 1 type IV beta 3 | Neuregulin 1 type IV beta 1a | HRG1 | NRG-1 | SMDF | Neuregulin 1 | Pro-NRG1 | HGL | MST131
Species
Human
Modifications
Animal-free. Also available Unmodified.
Conjugations
Unconjugated
Region
aa177-241 of Q02297-6
AA Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and HPLC
Bio-Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of human MCF-7 cells is <=0.5 ng/ml, corresponding to a specific activity of >=2 x 10^6 units/mg.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Presentation
Lyophilized
Reconstitution
Centrifuge the vial before opening. Reconstitute in water to 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week.
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About NRG1 / Heregulin / Neuregulin
Q02297 NM_013964 NP_039258.1

LSBio Ratings

Human NRG1 / Heregulin / Neuregulin Protein (Recombinant) - LS-G3634 has an LSBio Rating of
Publications (4)

Publications (1)

Cell Lineage-Based Stratification for Glioblastoma. Zilai Wang, Daochun Sun, Yu-Jung Chen, Xuanhua Xie, Yufeng Shi, Viviane Tabar, Cameron W Brennan, Tejus A Bale, Chenura D Jayewickreme, Dan R Laks, Sheila Alcantara Llaguno, Luis F Parada. Cancer cell. 2020 Sep;38:366-379.e8.

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/23/2024