Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21864-20 20 µg $311 
LS-G21864-100 100 µg $408 
LS-G21864-1 1 mg $1,207 
NABP1 / OBFC2A Protein

Human NABP1 / OBFC2A Protein (Recombinant His-SUMO) (Full Length) - LS-G21864

Human NABP1 / OBFC2A Protein (Recombinant His-SUMO) (Full Length) - LS-G21864

Description:
NABP1 / OBFC2A Protein LS-G21864 is a Recombinant Human NABP1 / OBFC2A produced in E. coli aa 1-204 with His-SUMO tag(s).
Price
Catalog Number
$311
LS-G21864-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
NABP1 / OBFC2A Protein LS-G21864 is a Recombinant Human NABP1 / OBFC2A produced in E. coli aa 1-204 with His-SUMO tag(s).

Specifications

Type
Recombinant Protein
Target
NABP1 / OBFC2A
Synonyms
NABP1 | SOSS-B2 | SSB2 | Nucleic acid binding protein 1 | Nucleic acid-binding protein 1 | HSSB2 | OBFC2A | Sensor of ssDNA subunit B2 | SOSS complex subunit B2
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-SUMO
Region
aa 1-204
Predicted Molecular Weight
38.4 kD
AA Sequence
MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About NABP1 / OBFC2A
Q96AH0 AK079434 Q96AH0

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NABP1 / OBFC2A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NABP1 / OBFC2A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NABP1 / OBFC2A Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

NABP1 / OBFC2A Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 7/1/2022