Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21920-20 20 µg $307 
LS-G21920-100 100 µg $400 
LS-G21920-1 1 mg $1,152 
MRPL20 Protein

Human MRPL20 Protein (Recombinant His-SUMO) (aa46-149) - LS-G21920

Human MRPL20 Protein (Recombinant His-SUMO) (aa46-149) - LS-G21920

Description:
MRPL20 Protein LS-G21920 is a Recombinant Human MRPL20 produced in E. coli aa 46-149 with His-SUMO tag(s).
Price
Catalog Number
$307
LS-G21920-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
MRPL20 Protein LS-G21920 is a Recombinant Human MRPL20 produced in E. coli aa 46-149 with His-SUMO tag(s).

Specifications

Type
Recombinant Protein
Target
MRPL20
Synonyms
MRPL20 | L20mt | MRP-L20
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His-SUMO
Region
aa 46-149
Predicted Molecular Weight
27.8 kD
AA Sequence
VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About MRPL20
Q9BYC9 NM_017971 NP_060441.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MRPL20 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MRPL20 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MRPL20 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

MRPL20 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/21/2021