Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G4777-50 50 µg $520 
LTA / TNF Beta Protein

Human LTA / TNF Beta Protein (Recombinant His) - LS-G4777

Human LTA / TNF Beta Protein (Recombinant His) - LS-G4777

Description:
LTA / TNF Beta Protein LS-G4777 is a Recombinant Human LTA / TNF Beta produced in E. coli with His tag(s). It is biologically active.
Price
Catalog Number
$520
LS-G4777-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
LTA / TNF Beta Protein LS-G4777 is a Recombinant Human LTA / TNF Beta produced in E. coli with His tag(s). It is biologically active.

Specifications

Type
Recombinant Protein
Target
LTA / TNF Beta
Synonyms
LTA | Lymphotoxin-alpha | LT-alpha | TNFSF1 | TNF-beta | TNFB | Tumor necrosis factor beta | LT | TNF Beta
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Predicted Molecular Weight
20.9 kDa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Measured in a cytotoxicity assay using L929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is <0.3 ng/ml.
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 30% Glycerol
Storage
Store at -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About LTA / TNF Beta
P01374 NM_000595 NP_000586.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LTA / TNF Beta Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LTA / TNF Beta Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LTA / TNF Beta Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

LTA / TNF Beta Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/20/2021