LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human KPNA5 Protein (Recombinant GST) (Full Length) - LS-G29139

Catalog Size Price
LS-G29139-10 10 µg Unavailable
LS-G29139-25 25 µg Unavailable
LSBio (USA Sales Only) LSBio (USA Sales Only)
206-374-1102
866-206-6909
Orders@LSBio.com
 

Most Popular KPNA5 Proteins

Human KPNA5 Protein (Recombinant GST) (Full Length) - LS-G29139
Wheat Wheat Germ Extract
539 AA
GST
Purified
12.5% SDS-PAGE of human KPNA5 stained with Coomassie Blue
Human KPNA5 Protein (Over-Expression Lysate Myc + DDK) - LS-G80069
Human 293T Cells
591 AA
Myc + DDK
Purified / Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
KPNA5 Protein (Over-Expression Lysate Myc + DDK) - LS-G99707
Human HEK 293 Cells
591 AA
Myc + DDK
Purified
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

100% Guaranteed
LS-G29139
Recombinant Protein
KPNA5
Human
85.03 kDa Full Length
MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVALGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQQQFIFQQQEAPMDGFQL
Wheat Germ Extract
Wheat
GST
Glutathione Sepharose
Not Tested
Not Tested
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Store at -80°C. Avoid freeze-thaw cycles.
For research use only.

About KPNA5

O15131 NM_002269 NP_002260.2

KPNA5 Protein, Importin subunit alpha-6 Protein, Karyopherin subunit alpha-5 Protein, IPOA6 Protein, Importin alpha 6 Protein, SRP6 Protein

Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

12.5% SDS-PAGE of human KPNA5 stained with Coomassie Blue
12.5% SDS-PAGE of human KPNA5 stained with Coomassie Blue

Requested From: 
Date Requested: 6/19/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number