LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human IL6R / IL6 Receptor Protein (Recombinant His, N-Terminal) - LS-G27255

Catalog
Size
Price
LS-G27255-10
10 µg
$205
LS-G27255-50
50 µg
$325
LS-G27255-1
1 mg
$1,905
Description
IL6R / IL6 Receptor Protein LS-G27255 is Recombinant Human IL6R / IL6 Receptor in Spodoptera frugiperda with His, N-Terminal tag(s). It is biologically active and is low in endotoxin Less than 0.2 EU/µg protein (determined by LAL method)..
Type
Recombinant Protein
Target
IL6R / IL6 Receptor
Species
Human
Predicted Molecular Weight
50 kDa (SDS-PAGE)
Details
Interleukin-6 Receptor (IL-6R) is a single trans-membrane protein that is the receptor for Interleukin-6 (IL-6). IL-6R forms a hexameric complex upon binding 2 molecules of IL-6 and two molecules of glycoprotein 130 (gp130) which activates intracellular JAK/STAT pathways. Although the normal form of IL-6R is the membrane-bound 80 kDa subunit, a soluble form of IL-6R (sIL-6R) can be generated physiologically by limited proteolysis or alternative splicing. sIL-6R binds to both IL-6 and gp130 generating intracellular signaling. In the immune system, sIL-6R is produced by both naive and memory CD4 T-cells and strongly augments IL-6 ligand's induction of Th-17 cells.Recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) with an N-terminal His tag produced in Sf9 insect cells is a single glycosylated polypeptide chain containing 350 amino acids. A fully biologically active molecule, rhsIL-6R alpha has a molecular mass of 50kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
AA Sequence
HHHHHHDDDDKLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
Expression System
Sf9 Cells
Source Species
Spodoptera frugiperda
Purification
Greater than 95% by non-reducing SDS-PAGE and HPLC
Bio-Activity
ED50 < 50ng/mL, as determined by the cytotoxicity assay using M1 cells in presence of 10 ng/mL of human IL-6, corresponding to a specific activity of > 2x104 units/mg.
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from PBS
Storage
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 2 weeks or at -20°c for up to 3 months.
Restrictions
For research use only.
About IL6R / IL6 Receptor
P08887 NM_000565 NP_000556.1

Popular IL6R / IL6 Receptor Proteins

Protein
Source: Hamster-Chinese CHO Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.2 EU/µg protein (determined by LAL method).
Protein
Source: Hamster-Chinese CHO Cells
Tag: Mouse IgG2 Fc
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.06 EU/µg protein (determined by LAL method).
Protein
Source: Human HEK 293 Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Recombinant Interleukin 6 Receptor By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Protein
Source: Hamster-Chinese CHO Cells
Tag: Human IgG1 Fc
Format: Purified / Lyophilized / Endotoxin Level: Less than 0.06 EU/µg protein (determined by LAL method).

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 7/22/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy