LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human IL15 Protein (Recombinant) - LS-G134055

Catalog
Size
Price
LS-G134055-2
2 µg
$205
LS-G134055-10
10 µg
$285
LS-G134055-100
100 µg
$530
LS-G134055-500
500 µg
$2,670
LS-G134055-1
1 mg
$4,455
Description
Human IL15 Protein (Recombinant) - LS-G134055
Type
Animal-Free  Recombinant Protein
Target
IL15
Species
Human
Predicted Molecular Weight
12.9 kDa
Details
Interleukin 15 (IL-15) is a widely expressed proinflammatory cytokine that is structurally and functionally related to interleukin 2 (IL-2). IL-15 signals through JAK kinases to activate STAT3, STAT5, and STAT6 transcription factors. IL-15 regulates the activation of T cells, neutrophils, and macrophages, and is a stimulatory cytokine promoting dendritic cell function. IL-15 expression is dysregulated in chronic inflammatory disorders, including rheumatoid arthritis, psoriasis, and pulmonary inflammatory diseases. Therefore, IL-15 may serve as an effective therapeutic target, due to the beneficial outcomes of IL-15 neutralization in models of psoriasis and diabetes. Human IL-15 shows activity on mouse cells.
AA Sequence
MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 95% by reducing and non-reducing SDS-PAGE
Bio-Activity
Determined by CTLL-2 Cell Proliferation; <= 5 ng/ml; >= 2.0x10^5 units/mg; 2.7x1^5 IU/ug
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from sterile filtered 10 mM sodium bicarbonate, pH 8.0
Reconstitution
Centrifuge vial before opening. Reconstitute with sterile water at 0.1 mg/mL. Suspend the product by gently pipetting the recommended solution down the sides of the vial. Do not vortex. Allow several minutes for complete reconstitution.
Storage
Shipped at room temperature. Prior to reconstitution, store at -20°C. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution. Store at -80°C and avoid freeze-thaw cycles.
Restrictions
For research use only.
About IL15
P40933 NM_000585 NP_000576.1

Popular IL15 Proteins

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: Yeast Expression System
Tag: 6His,N-terminus
Recombinant Interleukin 15 By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Protein
Source: E. coli Expression System
Tag: 6His,C-terminus
Format: Purified / Biologically Active
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein.

Publications (0)


Customer Reviews (0)


Images

Assay Result

Human IL-15 Induced Proliferation of Mo7e cells
Human IL-15 Induced Proliferation of Mo7e cells

Western blot

Human IL-15 Gel
Human IL-15 Gel

Assay Result

Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations
Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations

Assay Result

Human IL-15 Induced Proliferation of Mo7e cells
Human IL-15 Induced Proliferation of Mo7e cells

Western blot

Human IL-15 Gel
Human IL-15 Gel

Assay Result

Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations
Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations

Assay Result

Human IL-15 Induced Proliferation of Mo7e cells
Human IL-15 Induced Proliferation of Mo7e cells

Western blot

Human IL-15 Gel
Human IL-15 Gel

Assay Result

Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations
Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations

Assay Result

Human IL-15 Induced Proliferation of Mo7e cells
Human IL-15 Induced Proliferation of Mo7e cells

Western blot

Human IL-15 Gel
Human IL-15 Gel

Assay Result

Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations
Human IL-15 Induced Proliferation of CTLL2 cells for International Units Calculations

Requested From: United States
Date Requested: 3/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy