LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human IL11 Protein (Recombinant) - LS-G27182

Catalog
Size
Price
LS-G27182-5
5 µg
$235
LS-G27182-25
25 µg
$395
Description
IL11 Protein LS-G27182 is Recombinant Human IL11 in Hamster-Chinese It is biologically active and is low in endotoxin Less than 0.2 EU/µg protein (determined by LAL method)..
Type
Recombinant Protein
Target
IL11
Species
Human
Predicted Molecular Weight
~23 kDa (SDS-PAGE)
Details
Interleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1a-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple effects on both hematopoietic and non-hematopoietic cells. Many of the biological effects described for IL-11 overlap with those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell-dependent development of specific immunoglobulin-secreting B cells.
AA Sequence
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Expression System
CHO Cells
Source Species
Hamster-Chinese
Purification
Greater than 95% by SDS-PAGE and HPLC
Bio-Activity
ED50 <5 ng/ml, measured in a proliferation assay using T11 cells.
Endotoxin
Less than 0.2 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from PBS
Reconstitution
Reconstitute in sterile ddH20 or PBS at 100 ug/ml.
Storage
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 1 week or at -20°c for up to 2 months.
Restrictions
For research use only.
About IL11
P20809 NM_000641 NP_000632.1

Popular IL11 Proteins

Eukaryotic Interleukin 11 (IL11) by SDS-PAGE
Source: Human 293F Cells
Tag: His, N-Terminal
Format: Purified / Lyophilized / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Animal-Free / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 7/19/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy