LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human IFN Gamma / Interferon Gamma Protein (Recombinant) - LS-G3635

Catalog
Size
Price
LS-G3635-20
20 µg
$225
LS-G3635-100
100 µg
$295
Description
IFN Gamma / Interferon Gamma Protein LS-G3635 is Recombinant Human IFN Gamma / Interferon Gamma in E. coli It is biologically active and is low in endotoxin Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg)..
Type
Animal-Free  Recombinant Protein
Target
IFN Gamma / Interferon Gamma
Species
Human
Details
IFN-gamma is an acid-labile interferon produced by CD4 and CD8 T lymphocytes as well as activated NK cells. IFN-gamma receptors are present in most immune cells, which respond to IFN-gamma signaling by increasing the surface expression of class I MHC proteins. This promotes the presentation of antigen to T-helper (CD4+) cells. IFN-gamma signaling in antigen-presenting cells and antigen-recognizing B and T lymphocytes regulate the antigen-specific phases of the immune response. Additionally, IFN-gamma stimulates a number of lymphoid cell functions including the anti-microbial and anti-tumor responses of macrophages, NK cells, and neutrophils. Human IFN-gamma species-specific and is biologically active only in human and primate cells. Recombinant human IFN-gamma is a 16.8 kDa protein containing 144 amino acid residues.
AA Sequence
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and HPLC
Bio-Activity
Assay 1: Determined by its ability to induce apoptosis in HeLa cells. The expected ED50 for this effect is 5.0-10.0 ng/ml. Assay 2: The ED50 as determined by a cytotoxicity Assay using HT-29 cells is = 0.05 ng/ml, corresponding to a specific activity of = 2 x 10^7 units/mg.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Alternate Forms
Presentation
Lyophilized from 10mM sodium phosphate, pH 7.4.
Reconstitution
Reconstitute in distilled water to a concentration of 1.0 mg/mL
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About IFN Gamma / Interferon Gamma
P01579 NM_000619 NP_000610.2

Popular IFN Gamma / Interferon Gamma Proteins

Recombinant Interferon Gamma By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Recombinant Interferon Gamma By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Recombinant Interferon Gamma By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: None
Format: Purified / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 6/25/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy