Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G2794-50 50 µg (0.25 mg/ml) $315 
LS-G2794-250 250 µg (0.25 mg/ml) $695 
HPR Protein
HPR Protein
HPR Protein
HPR Protein
1 of 2
2 of 2

Human HPR Protein (Recombinant His) - LS-G2794

Human HPR Protein (Recombinant His) - LS-G2794

Description:
HPR Protein LS-G2794 is a Recombinant Human HPR produced in E. coli 20-348aa with His tag(s).
Price
Catalog Number
$315
LS-G2794-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
HPR Protein LS-G2794 is a Recombinant Human HPR produced in E. coli 20-348aa with His tag(s).

Specifications

Type
Recombinant Protein
Target
HPR
Synonyms
HPR | A-259H10.2 | Haptoglobin-related protein | Haptoglobin-related locus
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
20-348aa
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSLYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl buffer (pH 8.5) containing 20% glycerol, 1mM DTT, 0.15M NaCl.
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About HPR
P00739 NM_020995 NP_066275.3

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

HPR Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/2/2021