Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G4739-50 50 µg $538 
FKBP2 Protein

Human FKBP2 Protein (Recombinant) - LS-G4739

Human FKBP2 Protein (Recombinant) - LS-G4739

Description:
FKBP2 Protein LS-G4739 is a Recombinant Human FKBP2 produced in E. coli. It is biologically active.
Price
Catalog Number
$538
LS-G4739-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
FKBP2 Protein LS-G4739 is a Recombinant Human FKBP2 produced in E. coli. It is biologically active.

Specifications

Type
Recombinant Protein
Target
FKBP2
Synonyms
FKBP2 | 13 kDa FK506-binding protein | 13 kDa FKBP | Fk506-binding protein | FKBP-2 | FKBP13 | Immunophilin FKBP13 | FK506 binding protein 2, 13kDa | FKBP-13 | PPIase FKBP2 | Rapamycin-binding protein | Rotamase | PPIase | FK506-binding protein 2 | FK506-binding protein 2 (13kD) | Proline isomerase
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
13.4 kDa
AA Sequence
MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Specific activity is > 270 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of Suc-AAFP-pNA per minute at 25°C in Tris HCl pH 8.0 using chymotrypsin.
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 1 mM DTT, 10% Glycerol
Storage
Store at -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FKBP2
P26885 NM_004470 NP_004461.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FKBP2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FKBP2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FKBP2 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FKBP2 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/19/2021