LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human FGF7 / KGF Protein (Recombinant) - LS-G27133

Catalog Size Price
LS-G27133-10 10 µg Unavailable
LS-G27133-50 50 µg Unavailable
LS-G27133-1 1 mg Unavailable

Most Popular FGF7 / KGF Proteins

Human FGF7 / KGF Protein (Recombinant) - LS-G20
E. coli Expression System
163 AA
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Human FGF7 / KGF Protein (Recombinant) - LS-G3663
E. coli Expression System
163 AA
None
Purified / Lyophilized / Biologically Active / Animal-Free / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Human FGF7 / KGF Protein (Recombinant) - LS-G4220
E. coli Expression System
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein.
Human FGF7 / KGF Protein (Recombinant) - LS-G4835
Human Human Cells
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein.
Functional Assay Image
Human FGF7 / KGF Protein (Recombinant) - LS-G27132
E. coli Expression System
164 AA
None
Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.2 EU/µg protein (determined by LAL method).

100% Guaranteed
LS-G27133
Recombinant Protein
FGF7 / KGF
Human
21.2 kDa (SDS-PAGE)
Keratinocyte Growth Factor (KGF) is a highly specific epithelial mitogen produced by fibroblasts and mesenchymal stem cells. KGF belongs to the heparin binding Fibroblast Growth Factor (FGF) family, and is known as FGF-7. However, in contrast to the FGF-1, which binds to all known FGF receptors with high affinity, KGF only binds to a splice variant of an FGF receptor, FGFR2-IIIb. FGFR2-IIIb is produced by most of the epithelial cells, indicating that KGF plays roles as a paracrine mediator. KGF induces the differen-tiation and proliferation of various epithelial cells, including keratinocytes in the epidermis, hair follicles and sebaceous glands, and is responsible for the wound repairs of various tissues, including lung, bladder, and kidney. Recombinant human Keratinocyte Growth Factor (rhKGF) with N-terminal His-tag produced in E. coli is a single non-glycosylated polypeptide chain containing 181 amino acids. A fully biologically active molecule, rhKGF has a molecular mass of 21.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
MNHKVHHHHHHMDDDDKMCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAILKERIEENGYT
E. coli
E. coli
None
Greater than 95% by non-reducing SDS-PAGE and HPLC
ED50 < 10 ng/mL, as determined by a cell proliferation assay using 4MBr-5 cells, corresponding to a specific activity of > 1.0x 10^5 units/mg.
Less than 0.2 EU/µg protein (determined by LAL method).
Lyophilized from PBS.
Stable at -80°c for up to 6 months. Upon reconstitution, store at 4°c for up to 2 weeks or at -20°c for up to 3 months.
For research use only.

About FGF7 / KGF

P21781 NM_002009 NP_002000.1

FGF7 Protein, FGF-7 Protein, Fibroblast growth factor- 7 Protein, Keratinocyte growth factor Protein, Fibroblast growth factor 7 Protein, HBGF-7 Protein, KGF Protein

FGF7 / KGF is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells.

Requested From: 
Date Requested: 6/21/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number