LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

Human FGF7 / KGF Protein (Recombinant)

Catalog
Size
Price
LS-G23584-2
2 µg
$205
LS-G23584-10
10 µg
$285
LS-G23584-100
100 µg
$710
LS-G23584-500
500 µg
$3,555
LS-G23584-1
1 mg
$5,940
Description
FGF7 / KGF Protien LS-G23584 is Recombinant Human FGF7 / KGF in E. coli It is biologically active and is low in endotoxin Less than 1.0 EU/µg protein (determined by LAL method)..
Type
Animal-Free  Recombinant Protein
Target
FGF7 / KGF
Species
Human
Predicted Molecular Weight
19 kDa
Details
Fibroblast growth factor 7 (FGF7), also known as keratinocyte growth factor (KGF), is a potent mitogen that regulates epithelial cell migration and differentiation. FGF7 is produced by mesenchymal cells and binds in high affinity to a splice variant of FGF receptor 2 (FGFR2-IIIb). The mitogenic activity of FGF7 acts predominantly on keratinocytes, but not on fibroblast or endothelial cells. FGF7 expression is upregulated after acute and chronic injury, suggesting that FGF7 functions during the healing of injured epithelial cells. FGF7 also induces the formation of the apical ectoderm ridge during limb development. This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
AA Sequence
MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Tested using: 4MBr-5 cell proliferation. Less than or equal to 60 ng/mL and greater than or equal to 1.7 x 10^4 units/mg. Typical ED50 is less than 5 ng/mL.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from sterile filtered 10 mM sodium phosphate, pH 7.5, 100 mM sodium chloride
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Usage Summary
If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate.
Restrictions
For research use only.
About FGF7 / KGF
P21781 NM_002009 NP_002000.1

Popular FGF7 / KGF Proteins

Functional Assay Image
Source: Human Human Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein.
Protein
Source: E. coli Expression System
AA Sequence Size: 164 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.2 EU/µg protein (determined by LAL method).
Protein
Source: E. coli Expression System
AA Sequence Size: 163 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein (less than 1EU/µg).
Protein
Source: E. coli Expression System
AA Sequence Size: 163 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Animal-Free / Endotoxin Level: Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Protein
Source: E. coli Expression System
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 0.1 ng/µg of protein.

Publications (0)


Customer Reviews (0)


Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis


Requested From: United States
Date Requested: 1/23/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy