Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G23583-2 2 µg $248 
LS-G23583-10 10 µg $319 
LS-G23583-100 100 µg $704 
LS-G23583-500 500 µg $3,026 
LS-G23583-1 1 mg $5,042 
FGF7 / KGF Protein

Human FGF7 / KGF Protein (Recombinant) - LS-G23583

Human FGF7 / KGF Protein (Recombinant) - LS-G23583

Description:
FGF7 / KGF Protein LS-G23583 is a Recombinant Human FGF7 / KGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).
Price
Catalog Number
$248
LS-G23583-2
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
FGF7 / KGF Protein LS-G23583 is a Recombinant Human FGF7 / KGF produced in E. coli. It is biologically active and is low in endotoxin; Less than 1.0 EU/µg protein (determined by LAL method).

Specifications

Type
Recombinant Protein
Target
FGF7 / KGF
Synonyms
FGF7 | FGF-7 | Fibroblast growth factor- 7 | Keratinocyte growth factor | Fibroblast growth factor 7 | HBGF-7 | KGF
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Predicted Molecular Weight
19 kDa
AA Sequence
MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate.
Bio-Activity
Tested using: 4MBr-5 cell proliferation. Less than or equal to 60 ng/mL and greater than or equal to 1.7 x 10^4 units/mg. Typical ED50 is less than 5 ng/mL.
Endotoxin
Less than 1.0 EU/µg protein (determined by LAL method).
Presentation
Lyophilized from sterile filtered 10 mM sodium phosphate, pH 7.5, 100 mM sodium chloride
Reconstitution
Reconstitute in sterile water to 0.1 mg/ml
Storage
Store at -20°C to -80°C for up to 1 year. Store at 4°C for up to 1 month or up to 3 months at -20°C to -80°C after reconstitution.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGF7 / KGF
P21781 NM_002009 NP_002000.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF7 / KGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF7 / KGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF7 / KGF Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FGF7 / KGF Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/16/2021