LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
Human FGF2 / Basic FGF Protein (Recombinant) - LS-G3627
Catalog
Size
Price
LS-G3627-10
10 µg
$225
LS-G3627-50
50 µg
$295
Description
Human FGF2 / Basic FGF Protein (Recombinant) - LS-G3627
Type
Animal-Free  Recombinant Protein
Target
FGF2 / Basic FGF
Species
Human
AA Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE and HPLC
Bio-Activity
The ED50 as determined by a cell proliferation assay using balb/c 3T3 cells is <=0.05 ng/ml, corresponding to a specific activity of >=2 x 10^7 units/mg.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Storage
If lyophilized, can be stored for 1 month at room temperature, 6 months at 4°C, or through the expiration date at -20°C to -80°C. Once reconstituted per the supplied instructions, can be stored for 3 months at -20°C to -80°C, or for 1 week at 2°C to 8°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About FGF2 / Basic FGF
P09038 NM_002006 NP_001997.5

Popular FGF2 / Basic FGF Proteins

Protein
Source: Human HEK 293 Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active
Functional Assay Image
Source: Human Human Cells
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein.
Recombinant Fibroblast Growth Factor 2, Basic By SDS-PAGE
Source: E. coli Expression System
Tag: His
Format: Purified / Lyophilized
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
AA Sequence Size: 146 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).
Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image
Source: E. coli Expression System
AA Sequence Size: 146 AA
Tag: None
Format: Purified / Lyophilized / Biologically Active / Endotoxin Level: Less than 1.0 EU/µg protein (determined by LAL method).

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 12/12/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy