Products
Services
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G2642-100 100 µg (1 mg/ml) $315 
LS-G2642-500 500 µg $695 
FANK1 Protein

Human FANK1 Protein (Recombinant His) - LS-G2642

Human FANK1 Protein (Recombinant His) - LS-G2642

Description:
FANK1 Protein LS-G2642 is a Recombinant Human FANK1 produced in E. coli with His tag(s).
Price
Catalog Number
$315
LS-G2642-100
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
FANK1 Protein LS-G2642 is a Recombinant Human FANK1 produced in E. coli with His tag(s).

Specifications

Type
Recombinant Protein
Target
FANK1
Synonyms
FANK1 | HSD13
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
20 mM Tris-HCl, pH 8.0, 0.15 M NaCl, 0.1 mM PMSF, 20% glycerol, 1 mM DTT
Storage
Short term: store at 2°C to 8°C for up to 1 week. Long term: aliquot and store at -20°C to -80°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About FANK1
Q8TC84 Q8TC84

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FANK1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FANK1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FANK1 Protein

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

FANK1 Protein

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 2/26/2021