Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G65506-20 20 µg $1,107 
EF1G / EEF1G Protein - Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Human EF1G / EEF1G Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G65506

Human EF1G / EEF1G Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G65506

Available for shipment within the USA only
Description:
EF1G / EEF1G Protein LS-G65506 is a Recombinant Human EF1G / EEF1G produced in HEK 293 Cells with Myc-DDK (Flag) tag(s). For Research Use Only
Price
Catalog Number
$1,107
LS-G65506-20

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
EF1G / EEF1G Protein LS-G65506 is a Recombinant Human EF1G / EEF1G produced in HEK 293 Cells with Myc-DDK (Flag) tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
EF1G / EEF1G
Synonyms
EEF1G | EEF-1B gamma | EF-1-gamma | GIG35 | EF1G | Elongation factor 1-gamma | PRO1608
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
49.9 kDa
AA Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
> 80% as determined by SDS-PAGE and Coomassie blue staining
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage
Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About EF1G / EEF1G
P26641 NM_001404 NP_001395.1

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EF1G / EEF1G Protein - Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EF1G / EEF1G Protein - Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EF1G / EEF1G Protein - Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

EF1G / EEF1G Protein - Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein EEF1G was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/25/2024