Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G63763-2 2 µg $439 
DCAL1 / CLECL1 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.

Human DCAL1 / CLECL1 Protein (Recombinant GST, N-terminus) (aa82-167) - LS-G63763

Human DCAL1 / CLECL1 Protein (Recombinant GST, N-terminus) (aa82-167) - LS-G63763

Available for shipment within the USA only
Description:
DCAL1 / CLECL1 Protein LS-G63763 is a Recombinant Human DCAL1 / CLECL1 produced in Wheat Germ Extract aa 82-167 with GST, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$439
LS-G63763-2

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
DCAL1 / CLECL1 Protein LS-G63763 is a Recombinant Human DCAL1 / CLECL1 produced in Wheat Germ Extract aa 82-167 with GST, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
DCAL1 / CLECL1
Synonyms
CLECL1 | C-type lectin-like 1 | DC-associated lectin-1 | DCAL1 | DCAL-1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
GST, N-terminus
Region
aa 82-167
Predicted Molecular Weight
35.2 kDa
AA Sequence
DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
Expression System
Wheat Germ Extract
Source Species
Wheat
Purification
Glutathione Sepharose 4 Fast Flow
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Storage
Store at -80°C. Aliquot to avoid freeze-thaw cycles. Best used within 3 months.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About DCAL1 / CLECL1
Q8IZS7 Q8IZS7

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

DCAL1 / CLECL1 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

DCAL1 / CLECL1 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

DCAL1 / CLECL1 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

DCAL1 / CLECL1 Protein - 12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/24/2024