Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

Human Complement C5a Protein (Recombinant) - LS-G136255

Catalog
Size
Price
LS-G136255-5
5 µg
$225
LS-G136255-20
20 µg
$295
Description
Complement C5a Protein LS-G136255 is Recombinant Human Complement C5a in E. coli It is biologically active and is low in endotoxin Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg)..
Type
Animal-Free  Recombinant Protein
Target
Complement C5a
Species
Human
Predicted Molecular Weight
8.3 kDa
Details
Complement 5a (C5a) is an enzymatically generated glycoprotein belonging to the anaphylatoxin family of structurally and functionally related proteins. Generated upon the activation of the complement system, C5a, together with C4a, C3a, and the membrane attack complex (C5b-9), functions as a central player in host defense by inducing smooth muscle cell contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes through cell degranulation. In addition to acting as a direct mediator of localized inflammatory response, C5a also initiates both the synthesis and release of IL-8 from monocytes and bronchial epithelial cells, stimulates the proliferation of neurons and hepatocytes, and functions as a potent chemoattractant. Where C5a deficiency, a rare defect of the complement pathway caused by the mutation of the C5a gene, is associated with susceptibility to severe infections, excessive C5a activation has been linked to liver fibrosis, sepsis, adult respiratory distress syndrome, rheumatoid arthritis, Alzheimer’s disease, and ischemic heart disease. Human C5a shares 60% and 54% sequence identity to mouse and rat C5a, respectively. The human C5 gene encodes a 1,676 amino acid glycoprotein that is comprised of a disulfide-linked C5 alpha and a C5 beta chain, the former of which contains the active, 74 amino acid C5a anaphylatoxin chain. Recombinant Human C5a is an 8.3 kDa glycoprotein containing the 74 amino acid residues of the C5a anaphylatoxin chain.
AA Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE gel and HPLC analyses.
Bio-Activity
Measured by its ability to support adhesion of Human Umbilical Vein Endothelial Cells (HUVEC) to the Recombinant Human C5a-coated surface.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Presentation
Lyophilized from sterile filtered 10mM Tris, pH 7.5
Reconstitution
Centrifuge vial prior to opening. Do not vortex. Reconstitute with H2O to 0.1-1.0 mg/ml.
Storage
Before reconstitution: Short term: Room temperature; Long term: -20°C to -80°C. After reconstitution: Short term: 4°C; Long term: Aliquot and store with a carrier protein at -20°C to -80°C. Avoid freeze thaw cycles. Microcentrifuge before opening.
Restrictions
For research use only.

Popular Complement C5a Proteins

Recombinant Complement Component 5a By SDS-PAGE
Source: E. coli Expression System
Tag: His + GST
Format: Purified / Lyophilized

Publications (0)


Customer Reviews (0)


Requested From: United States
Date Requested: 9/15/2019