Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136255-5 5 µg $282 
LS-G136255-20 20 µg $370 
Protein

Human Complement C5a Protein (Recombinant) - LS-G136255

Human Complement C5a Protein (Recombinant) - LS-G136255

Description:
Complement C5a Protein LS-G136255 is a Recombinant Human Complement C5a produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only
Price
Catalog Number
$282
LS-G136255-5
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
Complement C5a Protein LS-G136255 is a Recombinant Human Complement C5a produced in E. coli. It is biologically active and is low in endotoxin; Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg). For Research Use Only

Specifications

Type
Recombinant Protein
Target
Complement C5a
Synonyms
C5a
Species
Human
Modifications
Animal-free
Conjugations
Unconjugated
Predicted Molecular Weight
8.3 kDa
AA Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 98% by SDS-PAGE gel and HPLC analyses.
Bio-Activity
Measured by its ability to support adhesion of Human Umbilical Vein Endothelial Cells (HUVEC) to the Recombinant Human C5a-coated surface.
Endotoxin
Less than 0.01 ng/µg of protein (Less than 0.1 EU/µg).
Presentation
Lyophilized from sterile filtered 10mM Tris, pH 7.5
Reconstitution
Centrifuge vial prior to opening. Do not vortex. Reconstitute with H2O to 0.1-1.0 mg/ml.
Storage
Before reconstitution: Short term: Room temperature; Long term: -20°C to -80°C. After reconstitution: Short term: 4°C; Long term: Aliquot and store with a carrier protein at -20°C to -80°C. Avoid freeze thaw cycles. Microcentrifuge before opening.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/28/2024