Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G21798-20 20 µg $323 
LS-G21798-100 100 µg $420 
LS-G21798-1 1 mg $1,355 
Protein

Human CD300LF / CD300f Protein (Recombinant His) (aa20-156) - LS-G21798

Human CD300LF / CD300f Protein (Recombinant His) (aa20-156) - LS-G21798

Description:
CD300LF / CD300f Protein LS-G21798 is a Recombinant Human CD300LF / CD300f produced in E. coli aa 20-156 with His tag(s).
Price
Catalog Number
$323
LS-G21798-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
CD300LF / CD300f Protein LS-G21798 is a Recombinant Human CD300LF / CD300f produced in E. coli aa 20-156 with His tag(s).

Specifications

Type
Recombinant Protein
Target
CD300LF / CD300f
Synonyms
CD300LF | CD300f antigen | CLM-1 | CLM1 | CMRF35-like molecule 1 | Igsf13 | Inhibitory receptor IREM1 | NK inhibitory receptor | IREM-1 | NKIR | CD300f | IREM1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
His
Region
aa 20-156
Predicted Molecular Weight
19.59 kD
AA Sequence
TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Expression System
E. coli
Source Species
E. coli
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Tris, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About CD300LF / CD300f
Q8TDQ1 NP_620587.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/7/2022