Fusion Protein

CD244

Human

Preservative Free. Also available Unmodified.

49.5 kDa

CHO Cells

Hamster-Chinese

A soluble molecule consisting of murine CD8 alpha signal peptide residual amino acids and linker: (1)kpqapegkgc(10), the mature extracellular domain of human CD244 (199aa): (11)qgsadhvvsisgvplqlqpnsiqtkvdsiawkkllpsqngfhhilkwengslpsntsndrfsfivknlsllikaaqqqdsglyclevtsisgkvqtatfqvfvfdkvekprlqgqgkildrgrcqvalsclvsrdgnvsyawyrgskliqtagnltyldeevdingthtytcnvsnpvsweshtlnltqdcqnahqefr(209), murine IgG2a Fc + hinge regions: (233aa) eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk (442aa total). The molecule has a predicted monomeric non glycosylated molecular weight of 49.5 kd. The molecule is dimeric. In SDS-PAGE, it runs at apporoximately 135 kD native, and 70 kD reduced. CD244-muIg binds to recombinant CD48 in EIA and cell surface CD48 on Raji cell surface in FACS. Recombinant soluble CD244-muIg was tested for binding in FACS. Five x 10^5 cultured human Raji cells per tube were washed and incubated 45 minutes on ice with 80 µl of Recombinant CD244-muIg at a concentration of 1 µg/ml. Cells were washed twice and incubated with secondary reagent Goat anti-Mouse IgG/FITC, after which they were washed three times, fixed and analyzed by FACS. Cells stained positive with a mean shift of 1.40 log10fluorescent units when compared to muIgFc Control Protein.

Not Tested

Not Tested

50 mM Sodium Phosphate, pH 7.5, 150 mM NaCl, 100 mM KCl

Store at 2°C to 5°C for up to 1 year. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This protein carries the LSBio 100% Guarantee.

Uniprot: Q9BZW8 NCBI: NM_016382 NP_057466.1