Fusion Protein

CD244

Human

Unmodified

49.5 kDa

CHO Cells

Hamster-Chinese

A soluble molecule consisting of murine CD8 alpha signal peptide residual amino acids and linker the mature extracellular domain of human CD244 (199aa) and murine IgG2a Fc + hinge regions: (1)kpqapegkgc(10), (11)qgsadhvvsisgvplqlqpnsiqtkvdsiawkkllpsqngfhhilkwengslpsntsndrfsfivknlsllikaaqqqdsglyclevtsisgkvqtatfqvfvfdkvekprlqgqgkildrgrcqvalsclvsrdgnvsyawyrgskliqtagnltyldeevdingthtytcnvsnpvsweshtlnltqdcqnahqefr(209), (233aa)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(442aa total). The molecule has a predicted monomeric non glycosylated molecular weight of 49.5 kd. The molecule is dimeric. In SDS-PAGE, it runs at apporoximately 135 kD native, and 70 kD reduced. CD244-muIg/Biotin was tested for binding ot cell surface CD48 on Raji cells.Five x 10^5 cultured Raji cells per tube were washed and incubated 45 minutes on ice with 80 µl of CD244-muIg/Biotin at a concentration of 10 µg/ml. Cells were washed twice and incubated with secondary reagent Streptavidin/R-PE, after which they were washed three times, fixed and analyzed by FACS. Cells stained positive with a mean shift of 1.79 log10 fluorescent units when compared to a muIgFc /Biotin negative control. Binding was blocked when cells were pre blocked 10 minutes with 20 µl of anti-CD48 antibody (Clone 5-4.8) at a concentration of 0.5 mg/ml.

Not Tested

Not Tested

50 mM Sodium Phosphate, pH 7.5, 150 mM NaCl, 100 mM KCl, 0.04% Sodium Azide, 5% Glycerol, 0.2% BSA

Store at 2°C to 5°C for up to 6 months. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This protein carries the LSBio 100% Guarantee.

Uniprot: Q9BZW8 NCBI: NM_016382 NP_057466.1