Products

Antibodies
All Antibodies
Primary Antibodies
Secondary Antibodies
IHC-plus Antibodies
Isotype Control Antibodies

ELISA and Assay Kits
All Kits
Assay Kits
Traditional ELISA Kits
Cell-Based ELISA Kits
DNA-Binding ELISA Kits
Phospho-Specific ELISA Kits
ELISA Development Kits
Chemiluminescent CLIA Kits

Proteins
All Proteins
Recombinant Proteins
Native Proteins
Over-expression Lysates
Cell and Tissue Lysates
Bio-active Proteins
Animal-free Proteins
Synthetic Peptides

Biochemicals
All Biochemicals

Immunohistochemistry
Immunohistochemistry Reagents
Comprehensive IHC Reports
Custom IHC Services
TCR Screening Services
IHC-plus Antibodies

Services

Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Have a question? CustomerSupport@LSBio.com

Research Areas

Cancer Research:
Breast Cancer IHC
Colorectal Cancer IHC
Lung Cancer IHC
Prostate Cancer IHC

Cell Cycle:
Apoptosis

Protein Family and Group:
Caspases
Chemokines

Resources

Purchasing
Product Ordering Terms and Conditions
Holiday Schedule
About the LSBio Guarantee
About Reviews

Reference Material
About LSBio (LifeSpan BioSciences Inc.)
About Our 2-million Specimen Tissue Bank
About Our IHC Validation Process
About Our IHC-plus™ Immunohistochemistry Protocol
Protocols

Secure Logins
Login to Our Secure ShareFile Site
Login to Our IHC Database

Distributors

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone:	866-819-4732 (Toll Free North America) 206-374-1102 (International)

Fax:	866-206-6909 (Toll Free North America) 206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Forgot password?

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Login Name*:
Email*:
Password*:
Confirm Password*:
Name:
Organization:
Role:

Fields marked with a * are required.

Wish List

View Cart

Human AUH Protein (Recombinant) - LS-G44848

Catalog	Size	Price
LS-G44848-5	5 µg	Unavailable

LSBio (USA Sales Only)

Phone:	206-374-1102
Fax:	866-206-6909
Email:	Orders@LSBio.com

Related Products

22 AUH Antibodies
6 AUH Proteins

Most Popular AUH Proteins

Human AUH Protein (Recombinant His) - LS-G1058

Source:	E. coli Expression System
AA Sequence Size:	293 AA
Tag:	His
Format:	Purified

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis Image

Human AUH Protein (Recombinant His) - LS-G17266

Source:	E. coli Expression System
Tag:	His
Format:	Purified

Human AUH Protein (Recombinant) - LS-G44848

Source:	E. coli Expression System
AA Sequence Size:	232 AA
Tag:	None
Format:	Purified

Human AUH Protein (Recombinant GST,N-terminus) (aa44-135) - LS-G57867

Source:	Wheat Wheat Germ Extract
AA Sequence Size:	92 AA
Tag:	GST,N-terminus

12.5% SDS-PAGE Stained with Coomassie Blue.

Human AUH Protein (Recombinant Myc + DDK) - LS-G69200

Source:	Human HEK 293 Cells
AA Sequence Size:	391 AA
Tag:	Myc + DDK
Format:	Purified

Purified recombinant protein AUH was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Catalog Number:	LS-G44848
Type:	Recombinant Protein
Target:	AUH
Species:	Human
AA Sequence:	MGSSHHHHHHSSGLVPRGSHMSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREF

Expression System:	E. coli
Source Species:	E. coli
Tag:	None
Purification:	Greater than 95% by SDS-PAGE
Bio-Activity:	Not Tested
Endotoxin:	Not Tested
Presentation:	20 mM Tris HCl, pH 8.0, 0.1 M NaCl, 1 mM DTT, 20% glycerol
Restrictions:	For research use only.

About AUH

Uniprot: Q13825 NCBI: NM_001698 NP_001689.1

Synonyms: AUH Protein

Description: The methylglutaconyl-CoA hydratase, mitochondrial protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity.

(More About AUH)

Print This Page Email

Technical Help Review

Review This Product

Requested From:
Date Requested: 6/23/2018

Get Social With Us!

Catalog Number