Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G64924-20 20 µg $1,005 
ANPEP / CD13 Protein - Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Human ANPEP / CD13 Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G64924

Human ANPEP / CD13 Protein (Recombinant Myc-DDK (Flag)) (Full Length) - LS-G64924

Available for shipment within the USA only
Description:
ANPEP / CD13 Protein LS-G64924 is a Recombinant Human ANPEP / CD13 produced in HEK 293 Cells with Myc-DDK (Flag) tag(s).
Price
Catalog Number
$1,005
LS-G64924-20

Available for USA Shipment Only
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
ANPEP / CD13 Protein LS-G64924 is a Recombinant Human ANPEP / CD13 produced in HEK 293 Cells with Myc-DDK (Flag) tag(s).

Specifications

Type
Recombinant Protein
Target
ANPEP / CD13
Synonyms
ANPEP | Alanyl aminopeptidase | Aminopeptidase M | APN | Aminopeptidase N | AP-N | AP-M | CD13 | CD13 antigen | HAPN | gp150 | p150 | PEPN | Microsomal aminopeptidase | LAP1
Species
Human
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
106.3 kDa
AA Sequence
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYQVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLIRIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDYWLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
> 80% as determined by SDS-PAGE and Coomassie blue staining
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage
Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About ANPEP / CD13
P15144 NM_001150 NP_001141.2

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ANPEP / CD13 Protein - Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ANPEP / CD13 Protein - Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ANPEP / CD13 Protein - Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

ANPEP / CD13 Protein - Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Purified recombinant protein ANPEP was analyzed by SDS-PAGE gel and Coomassie Blue Staining

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/29/2022