LSBio
Products
  • Antibodies
  • All Antibodies
  • Primary Antibodies
  • Secondary Antibodies
  • IHC-plus Antibodies
  • Isotype Control Antibodies
  • ELISA and Assay Kits
  • All Kits
  • Assay Kits
  • Traditional ELISA Kits
  • Cell-Based ELISA Kits
  • DNA-Binding ELISA Kits
  • Phospho-Specific ELISA Kits
  • ELISA Development Kits
  • Chemiluminescent CLIA Kits
  • Proteins
  • All Proteins
  • Recombinant Proteins
  • Native Proteins
  • Over-expression Lysates
  • Cell and Tissue Lysates
  • Bio-active Proteins
  • Animal-free Proteins
  • Synthetic Peptides
  • Biochemicals
  • All Biochemicals

  • Immunohistochemistry
  • Immunohistochemistry Reagents
  • Comprehensive IHC Reports
  • Custom IHC Services
  • TCR Screening Services
  • IHC-plus Antibodies
Services
  • Immunohistochemistry Services

  • Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

  • TCR Screening Services

  • Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".
Have a question? CustomerSupport@LSBio.com
Research Areas
  • Cancer Research:
  • Breast Cancer IHC
  • Colorectal Cancer IHC
  • Lung Cancer IHC
  • Prostate Cancer IHC
  • Cell Cycle:
  • Apoptosis
  • Protein Family and Group:
  • Caspases
  • Chemokines
Resources
  • Purchasing
  • Product Ordering Terms and Conditions
  • Holiday Schedule
  • About the LSBio Guarantee
  • About Reviews
  • Reference Material
  • About LSBio (LifeSpan BioSciences Inc.)
  • About Our 2-million Specimen Tissue Bank
  • About Our IHC Validation Process
  • About Our IHC-plus™ Immunohistochemistry Protocol
  • Protocols
  • Secure Logins
  • Login to Our Secure ShareFile Site
  • Login to Our IHC Database
Distributors
Contact Us

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)
How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login ▾
Wish List
View Cart

Human ALDH3B2 Protein (Recombinant GST) (Full Length) - LS-G27419

Catalog Size Price
LS-G27419-10 10 µg Unavailable
LS-G27419-25 25 µg Unavailable
LSBio (USA Sales Only) LSBio (USA Sales Only)
206-374-1102
866-206-6909
Orders@LSBio.com
 

Most Popular ALDH3B2 Proteins

Human ALDH3B2 Protein (Recombinant GST) (Full Length) - LS-G27419
Wheat Wheat Germ Extract
385 AA
GST
Purified
12.5% SDS-PAGE of human ALDH3B2 stained with Coomassie Blue
Human ALDH3B2 Protein (Over-Expression Lysate Myc + DDK) - LS-G75373
Human 293T Cells
437 AA
Myc + DDK
Purified / Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Human ALDH3B2 Protein (Over-Expression Lysate Myc + DDK) - LS-G75374
Human 293T Cells
437 AA
Myc + DDK
Purified / Lyophilized
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
ALDH3B2 Protein (Over-Expression Lysate Myc + DDK) - LS-G120761
Human HEK 293 Cells
437 AA
Myc + DDK
Purified
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
ALDH3B2 Protein (Over-Expression Lysate Myc + DDK) - LS-G123037
Human HEK 293 Cells
437 AA
Myc + DDK
Purified
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

100% Guaranteed
LS-G27419
Recombinant Protein
ALDH3B2
Human
68.09 kDa Full Length
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Wheat Germ Extract
Wheat
GST
Glutathione Sepharose
Not Tested
Not Tested
50 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione
Store at -80°C. Avoid freeze-thaw cycles.
For research use only.

About ALDH3B2

P48448 NM_000695 NP_000686.2

ALDH3B2 Protein, Acetaldehyde dehydrogenase 8 Protein, ALDH8 Protein, Aldehyde dehydrogenase 8 Protein

ALDH3B2 encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

12.5% SDS-PAGE of human ALDH3B2 stained with Coomassie Blue
12.5% SDS-PAGE of human ALDH3B2 stained with Coomassie Blue

Requested From: 
Date Requested: 6/24/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number