Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G118580-100 100 µg (1 mg/ml) $395 
HFH-4 / FOXJ1 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

HFH-4 / FOXJ1 Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G118580

HFH-4 / FOXJ1 Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G118580

Available for shipment within the USA only
Description:
HFH-4 / FOXJ1 Protein LS-G118580 is an Over-Expression Lysate HFH-4 / FOXJ1 with Myc-DDK (Flag) tag(s).
Price
Catalog Number
$395
LS-G118580-100

Available for USA Shipment Only
Toll Free North America
866-819-4732
For Research Use Only

Overview

Description:
HFH-4 / FOXJ1 Protein LS-G118580 is an Over-Expression Lysate HFH-4 / FOXJ1 with Myc-DDK (Flag) tag(s).

Specifications

Type
Over-Expression Lysate Protein
Target
HFH-4 / FOXJ1
Synonyms
FOXJ1 | Fork head homologue 4 | Forkhead box J1 | Forkhead box protein J1 | HFH-4 | Forkhead-like 13 | HFH4 | FKHL13
Modifications
Unmodified
Conjugations
Unconjugated
Tag
Myc-DDK (Flag)
Predicted Molecular Weight
45.2 kDa
AA Sequence
MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL(CloningSiteandTags:myc-FLAG tag)
Expression System
HEK 293 Cells
Source Species
Human
Purification
Unpurified
Usage Summary
Intended for use as a Western blot control. Spin down briefly and dilute with 2xSDS Sample Buffer provided (4% SDS, 125mM Tris-HCl pH6.8, 10% Glycerol, 0.002% Bromphenol blue, 100mM DTT). Prior to SDS-PAGE fractionation, boil the lysate for 5 -10 minutes.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
Storage
Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.
Restrictions
For research use only. Intended for use by laboratory professionals. Available for shipment within the USA only
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About HFH-4 / FOXJ1
Q92949 NM_001454 NP_001445.2

Publications (0)

Customer Reviews (0)

Images

Western blot

HFH-4 / FOXJ1 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

HFH-4 / FOXJ1 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

HFH-4 / FOXJ1 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Western blot

HFH-4 / FOXJ1 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 3/2/2021