Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G137252-20 20 µg $405 
LS-G137252-100 100 µg $598 
LS-G137252-1 1 mg $1,679 
Protease 7 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Protease 7 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
1 of 3
2 of 3
3 of 3

E. coli Protease 7 Protein (Recombinant 6His-SUMO, N-terminus) (Full Length) - LS-G137252

E. coli Protease 7 Protein (Recombinant 6His-SUMO, N-terminus) (Full Length) - LS-G137252

Description:
Protease 7 Protein LS-G137252 is a Recombinant E. coli Protease 7 produced in E. coli 21-317aa with 6His-SUMO, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G137252-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
Protease 7 Protein LS-G137252 is a Recombinant E. coli Protease 7 produced in E. coli 21-317aa with 6His-SUMO, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
Protease 7
Synonyms
ompT
Species
E. coli
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-SUMO, N-terminus
Region
21-317aa
Predicted Molecular Weight
49.5 kDa
AA Sequence
STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Usage Summary
Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About Protease 7
P09169

Publications (0)

Customer Reviews (0)

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Protease 7 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Protease 7 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Protease 7 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

Protease 7 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Mass Cytometry

Protease 7 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Escherichia coli Protease 7(ompT) could indicate that this peptide derived from E.coli-expressed Escherichia coli O157:H7 ompT.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/1/2024