Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Proteins > botD > LS-G137211
 
Print Page  
Catalog Number Size Price
LS-G137211-20 20 µg $405 
LS-G137211-100 100 µg $598 
LS-G137211-1 1 mg $1,679 
botD Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
botD Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
1 of 3
2 of 3
3 of 3

Clostridium botulinum botD Protein (Recombinant 6His-B2M, N-terminus) - LS-G137211

Clostridium botulinum botD Protein (Recombinant 6His-B2M, N-terminus) - LS-G137211

Submit Review LSBio Guarantee
Description:
botD Protein LS-G137211 is a Recombinant Clostridium botulinum botD produced in E. coli 1-442aa with 6His-B2M, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G137211-20
Toll Free North America
206-374-1102
For Research Use Only
Specifications Publications Reviews Images Request SDS/MSDS

Overview

Description:
botD Protein LS-G137211 is a Recombinant Clostridium botulinum botD produced in E. coli 1-442aa with 6His-B2M, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
botD
Synonyms
botD
Species
Clostridium botulinum
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His-B2M, N-terminus
Region
1-442aa
Predicted Molecular Weight
64.5 kDa
AA Sequence
MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSNPSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYGINIPSDKRIRPQVSEGFFSQDGPNVQFEELYTFGGLDVEIIPQIERSQLREKALGHYKDIAKRLNNINKTIPSSWISNIDKYKKIFSEKYNFDKDNTGNFVVNIDKFNSLYSDLTNVMSEVVYSSQYNVKNRTHYFSRHYLPVFANILDDNIYTIRDGFNLTNKGFNIENSGQNIERNPALQKLSSESVVDLFTKVCLRLTK
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that cleaves the '60-Lys-|-Leu-61' bond of synaptobrevins-1 and -2.
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About botD
P19321 P19321

Publications (0)

Submit a Publication for LS-G137211

Customer Reviews (0)

Submit a review for LS-G137211

Images

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

botD Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

botD Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

botD Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

botD Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Mass Cytometry

botD Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial could indicate that this peptide derived from E.coli-expressed Clostridium botulinum botD.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/27/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com