Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136489-20 20 µg $405 
LS-G136489-100 100 µg $598 
LS-G136489-1 1 mg $1,679 
RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
RPS13 / Ribosomal Protein S13 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
RPS13 / Ribosomal Protein S13 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Ciona intestinalis RPS13 / Ribosomal Protein S13 (Recombinant 6His, N-terminus) (Full Length) - LS-G136489

Ciona intestinalis RPS13 / Ribosomal Protein S13 (Recombinant 6His, N-terminus) (Full Length) - LS-G136489

Description:
RPS13 / Ribosomal Protein S13 Protein LS-G136489 is a Recombinant Ciona intestinalis RPS13 / Ribosomal Protein S13 produced in E. coli 2-151aa with 6His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136489-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
RPS13 / Ribosomal Protein S13 Protein LS-G136489 is a Recombinant Ciona intestinalis RPS13 / Ribosomal Protein S13 produced in E. coli 2-151aa with 6His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
RPS13 / Ribosomal Protein S13
Synonyms
RPS13 | 40S ribosomal protein S13 | Ribosomal protein S13 | S13
Species
Ciona intestinalis
Modifications
Unmodified
Conjugations
Unconjugated
Tag
6His, N-terminus
Region
2-151aa
Predicted Molecular Weight
23.9 kDa
AA Sequence
GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 90% by SDS-PAGE
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About RPS13 / Ribosomal Protein S13
P62277 NM_001017 NP_001008.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPS13 / Ribosomal Protein S13 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPS13 / Ribosomal Protein S13 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPS13 / Ribosomal Protein S13 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Mass Cytometry

RPS13 / Ribosomal Protein S13 Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) could indicate that this peptide derived from E.coli-expressed Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) RPS13.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

RPS13 / Ribosomal Protein S13 Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/30/2024