Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-B11919-50 50 µl (3.39 mg/ml) $460 
CD33 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD33 Antibody - Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD33 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD33 Antibody - Western blot analysis of extracts of various cell lines, using CD33 antibody.
CD33 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD33 Antibody - Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD33 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
CD33 Antibody - Western blot analysis of extracts of various cell lines, using CD33 antibody.
1 of 4
2 of 4
3 of 4
4 of 4

PathPlus™ Polyclonal Rabbit anti‑Human CD33 Antibody (IHC, WB) LS‑B11919

PathPlus™ Polyclonal Rabbit anti‑Human CD33 Antibody (IHC, WB) LS‑B11919

Note: This antibody replaces LS-C331865, LS-C192720
Antibody:
CD33 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$460
LS-B11919-50
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
CD33 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CD33 is an adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha-2,6-linked sialic acid. In the immune response, CD33 acts as an inhibitory receptor upon ligand-induced tyrosine phosphorylation. It recruits cytoplasmic phosphatase(s) via their SH2 domain(s), which block signal transduction through dephosphorylation of signaling molecules. CD33 induces apoptosis in acute myeloid leukemia in vitro. In immunohistochemistry, CD33 has membranous and cytoplasmic positivity in populations of hematopoietic and lymphoid cells in immune tissues, the lung, and blood, and it is found on microglial cells in the brain and at low levels in other tissues throughout the body. References: The UniProt Consortium. Nucleic Acids Res. 47: D506-515 (2019); Nucleic Acids Res. 2016 Jan 4;44(D1):D733-45, PMID:26553804;
Target
Human CD33
Synonyms
CD33 | CD33 antigen | CD33 molecule | gp67 | SIGLEC-3 | p67 | CD33 antigen (gp67) | SIGLEC3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 49-259 of human CD33 (NP_001763.3). YYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Specificity
Human CD33
Applications
  • IHC - Paraffin (5 µg/ml)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 25kDa/33kDa/39kDa, while the observed MW by Western blot was 67kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at 4°C, avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CD33
P20138 NM_001772 NP_001763.3

Validation

CD33 Antibody - Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)

CD33 Antibody - Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)

CD33 Antibody - Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)

LSBio Ratings

PathPlus™ CD33 Antibody for IHC, WB/Western LS-B11919 has an LSBio Rating of
Laboratory Validation Score (5)

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/22/2021