Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C782249-100 100 µg $575 
UBE2I / UBC9 Antibody - IHC staining of FFPE mouse brain with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human appendicitis with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE rat lung with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE rat brain with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human glioma with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human placenta with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human stomach cancer with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human lung cancer with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - Western blot testing of 1) human K562, 2) human HepG2, 3) rat kidney, 4) rat spleen, 5) rat ovary, 6) mouse spleen, 7) mouse ovary and 8) mouse liver lysate with UBC9 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.
UBE2I / UBC9 Antibody - IHC staining of FFPE mouse brain with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human appendicitis with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE rat lung with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE rat brain with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human glioma with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human placenta with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human stomach cancer with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - IHC staining of FFPE human lung cancer with UBC9 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
UBE2I / UBC9 Antibody - Western blot testing of 1) human K562, 2) human HepG2, 3) rat kidney, 4) rat spleen, 5) rat ovary, 6) mouse spleen, 7) mouse ovary and 8) mouse liver lysate with UBC9 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.
1 of 9
2 of 9
3 of 9
4 of 9
5 of 9
6 of 9
7 of 9
8 of 9
9 of 9

Polyclonal Rabbit anti‑Human UBE2I / UBC9 Antibody (IHC, WB) LS‑C782249

Polyclonal Rabbit anti‑Human UBE2I / UBC9 Antibody (IHC, WB) LS‑C782249

Antibody:
UBE2I / UBC9 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$575
LS-C782249-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
UBE2I / UBC9 Rabbit anti-Human Polyclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
UBC9 antibody LS-C782249 is an unconjugated rabbit polyclonal antibody to UBC9 (UBE2I) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human UBE2I / UBC9
Synonyms
UBE2I | C358B7.1 | SUMO-conjugating enzyme UBC9 | UBC9 | SUMO-protein ligase | UBCE9 | Ubiquitin carrier protein 9 | Ubiquitin carrier protein I | Ubiquitin-protein ligase I | p18 | SUMO-1-protein ligase | Ubiquitin conjugating enzyme 9 | Ubiquitin-protein ligase E2I
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Antigen Affinity purification
Modifications
Unmodified
Immunogen
Amino acids NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS were used as the immunogen for the UBC9 antibody.
Applications
  • IHC - Paraffin (1 - 2 µg/ml)
  • Western blot (0.5 - 1 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Optimal dilution of the UBC9 antibody should be determined by the researcher.
Presentation
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Reconstitution
Reconstitute with 0.2ml distilled water
Storage
After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About UBE2I / UBC9
P63279 NM_003345 NP_003336.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/20/2024