Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > TMEM107 > LS-C662225
 
Print Page  
Catalog Number Size Price
LS-C662225-10 10 µg $318 
LS-C662225-100 100 µg $470 
TMEM107 Antibody - Immunohistochemistry - Anti-TMEM107 Picoband Antibody
TMEM107 Antibody - Immunohistochemistry - Anti-TMEM107 Picoband Antibody
TMEM107 Antibody - Western blot analysis of TMEM107 using anti-TMEM107 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: MCF-7 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TMEM107 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TMEM107 at approximately 22KD. The expected band size for TMEM107 is at 16KD.
TMEM107 Antibody - Western blot - Anti-TMEM107 Picoband Antibody
TMEM107 Antibody - Flow Cytometry analysis of SiHa cells using anti-TMEM107 antibody. Overlay histogram showing SiHa cells stained with anti-TMEM107 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-TMEM107 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
TMEM107 Antibody - Immunohistochemistry - Anti-TMEM107 Picoband Antibody
TMEM107 Antibody - Immunohistochemistry - Anti-TMEM107 Picoband Antibody
TMEM107 Antibody - Western blot analysis of TMEM107 using anti-TMEM107 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: MCF-7 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TMEM107 antigen affinity purified polyclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TMEM107 at approximately 22KD. The expected band size for TMEM107 is at 16KD.
TMEM107 Antibody - Western blot - Anti-TMEM107 Picoband Antibody
TMEM107 Antibody - Flow Cytometry analysis of SiHa cells using anti-TMEM107 antibody. Overlay histogram showing SiHa cells stained with anti-TMEM107 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-TMEM107 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human TMEM107 Antibody (IHC, WB) LS‑C662225

Polyclonal Rabbit anti‑Human TMEM107 Antibody (IHC, WB) LS‑C662225

Submit Review LSBio Guarantee
Antibody:
TMEM107 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C662225-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
TMEM107 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
TMEM107 antibody LS-C662225 is an unconjugated rabbit polyclonal antibody to human TMEM107. Validated for IHC and WB.
Target
Human TMEM107
Synonyms
TMEM107 | Transmembrane protein 107 | GRVS638 | PRO1268
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human TMEM107 (22-57 aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids.
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TMEM107
Q6UX40 NM_032354 NP_115730.2

Publications (0)

Submit a Publication for LS-C662225

Customer Reviews (0)

Submit a review for LS-C662225

Featured Products

TMEM107 Antibody - Anti-TMEM107 antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
IHC‑plus™ TMEM107 Antibody LS‑B10131
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
TMEM107 Antibody - TMEM107 antibody Western blot of THP-1 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
TMEM107 Antibody (aa21‑70) LS‑C117142
Species: Human
Applications: Western blot
TMEM107 Antibody - TMEM107 antibody Western blot of THP-1 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
TMEM107 Antibody (aa21‑70, Biotin) LS‑C452461
Species: Human, Chimpanzee, Rat, Bovine, Dog, Guinea pig
Applications: Western blot
TMEM107 Antibody - TMEM107 antibody Western blot of THP-1 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
TMEM107 Antibody (aa21‑70, FITC) LS‑C452462
Species: Human, Chimpanzee, Rat, Bovine, Dog, Guinea pig
Applications: Western blot
TMEM107 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Human TMEM107 Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G86815
Source: Human
Tag: Myc-DDK (Flag)
TMEM107 Protein - Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
TMEM107 Protein (Over-Expression Lysate Myc-DDK (Flag)) (Full Length) - LS-G103991
Source: Human
Tag: Myc-DDK (Flag)
See all TMEM107 Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 4/27/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com