LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

TLR8 Antibody (aa81-109) LS-C83989

Antibody

TLR8 Antibody (aa81-109) LS-C83989

Antibody:
Goat Polyclonal to Human TLR8
Application:
ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$455 
LS-C83989-200
Toll Free North America
866-819-4732

Overview

Antibody:
Goat Polyclonal to Human TLR8
Application:
ICC, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
TLR8 antibody LS-C83989 is an unconjugated goat polyclonal antibody to human TLR8. Validated for ICC and WB.

Target
Human TLR8
Host
Goat
Reactivity
Human (tested or 100% immunogen sequence identity)
Predicted
Monkey (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • ICC (1:200)
  • Western blot
Immunogen
TLR8 antibody was raised against 30 amino acid (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey (93%); Marmoset (86%).
Epitope
aa81-109
Specificity
Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.
Presentation
PBS, 1 mg/ml BSA, 0.1% Sodium Azide
Storage
Store at -20°C. Aliquot to avoid freeze/thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About TLR8
Q9NR97 NM_138636 NP_619542.1

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 0.63-40 ng/ml
Reactivity: Human
Range: 78.125-5000 pg/ml
Reactivity: Mouse
Range: 78.13-5000 pg/ml
Renal tissue presenting zygomycosis stained with Mouse anti-Rhizopus Arrhizus
Species: Fungus
Applications: IHC - Paraffin, Western blot, ELISA

Requested From: United States
Date Requested: 6/26/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy