Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C39256-100 100 µg $645 
Antibody

Polyclonal Rabbit anti‑Human STAT1 Antibody (aa712‑750, WB) LS‑C39256

Polyclonal Rabbit anti‑Human STAT1 Antibody (aa712‑750, WB) LS‑C39256

Antibody:
STAT1 Rabbit anti-Human Polyclonal (aa712-750) Antibody
Application:
WB, IP
Reactivity:
Human, Dog, Horse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$645
LS-C39256-100
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
STAT1 Rabbit anti-Human Polyclonal (aa712-750) Antibody
Application:
WB, IP
Reactivity:
Human, Dog, Horse
Format:
Unconjugated, Unmodified

Specifications

Description
STAT1 antibody LS-C39256 is an unconjugated rabbit polyclonal antibody to STAT1 (aa712-750) from human. It is reactive with human, dog and horse. Validated for IP and WB.
Target
Human STAT1
Synonyms
STAT1 | ISGF-3 | STAT91 | CANDF7
Host
Rabbit
Reactivity
Human, Dog, Horse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Purified
Modifications
Unmodified
Immunogen
A 39 residue synthetic peptide VHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV based on the human STAT1alpha (aa 712-750) was synthesized and the peptide coupled to KLH. The sequence differs from that of mouse by four amino acids. The C-Terminus 38. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Panda, Dog, Horse (100%); Marmoset, Sheep, Elephant, Bovine, Bat (97%); Pig (94%); Mouse, Hamster, Rabbit (87%); Opossum (84%); Rat (81%).
Epitope
aa712-750
Specificity
Detects a ~97kD protein, corresponding to the apparent molecular mass of STAT1alpha on SDS-PAGE immunoblots, in human, mouse, rat and bovine cell lysates and tissue extracts. This antibody does not detect the 84kD STAT1beta.
Applications
  • Western blot
  • Immunoprecipitation
Usage
Western Blot (ECL): 0.5 ug/mL. Immunoprecipitation: 2-4 ug/sample. Positive control: HeLa Cell Lysate.
Presentation
PBS, pH 7.2, 0.02% sodium azide. Supplied as an IgG fraction.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About STAT1
P42224 NM_007315 NP_009330.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 8/11/2022