LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

SOD3 Antibody LS-C662737

Immunohistochemistry - Anti-SOD3/Ec Sod Picoband antibody
Immunohistochemistry - Anti-SOD3/Ec Sod Picoband antibody
Immunohistochemistry - Anti-SOD3/Ec Sod Picoband antibody
Immunohistochemistry - Anti-SOD3/Ec Sod Picoband antibody
1 of 2
2 of 2

SOD3 Antibody LS-C662737

Antibody:
Rabbit Polyclonal to Human SOD3
Application:
IHC, IHC-P
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$355 
LS-C662737-100
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human SOD3
Application:
IHC, IHC-P
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
SOD3 antibody LS-C662737 is an unconjugated rabbit polyclonal antibody to human SOD3. Validated for IHC.

Target
Human SOD3
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
SOD3 antibody was raised against a synthetic peptide corresponding to a sequence of human SOD3 (WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDD).
Specificity
Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
Presentation
4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3 per 100ug antibody
Reconstitution
0.2ml of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SOD3
P08294 NM_003102 NP_003093.2

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 0.94-60 ng/ml
Product
Species: Human
Applications: Western blot, Flow Cytometry, ELISA
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Anti-DES / Desmin antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 3.75 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Chicken
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay

Requested From: United States
Date Requested: 5/24/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy