Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C408105-10 10 µg $318 
LS-C408105-100 100 µg $470 
SMYD3 Antibody - SMYD3 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
SMYD3 Antibody - Western blot analysis of SMYD3 expression in HELA whole cell lysates (lane 1) and COLO320 whole cell lysates (lane 2). SMYD3 at 55 kD was detected using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
SMYD3 Antibody - SMYD3 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
SMYD3 Antibody - Western blot analysis of SMYD3 expression in HELA whole cell lysates (lane 1) and COLO320 whole cell lysates (lane 2). SMYD3 at 55 kD was detected using rabbit anti- SMYD3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human SMYD3 Antibody (aa388‑428, IHC, WB) LS‑C408105

Polyclonal Rabbit anti‑Human SMYD3 Antibody (aa388‑428, IHC, WB) LS‑C408105

Antibody:
SMYD3 Rabbit anti-Human Polyclonal (aa388-428) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Dog, Horse, Pig, Rabbit
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C408105-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
SMYD3 Rabbit anti-Human Polyclonal (aa388-428) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Dog, Horse, Pig, Rabbit
Format:
Unconjugated, Unmodified

Specifications

Description
SMYD3 antibody LS-C408105 is an unconjugated rabbit polyclonal antibody to SMYD3 (aa388-428) from human. It is reactive with human, dog, horse and other species. Validated for IHC and WB.
Target
Human SMYD3
Synonyms
SMYD3 | BA74P14.1 | BA74P14.1 (novel protein) | KMT3E | ZMYND1 | ZNFN3A1
Host
Rabbit
Reactivity
Human, Dog, Horse, Pig, Rabbit (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human SMYD3 (388-428 aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS), different from the related mouse sequence by one amino acid.
Epitope
aa388-428
Specificity
Expressed in skeletal muscles and testis. Overexpressed in a majority of colorectal and hepatocellular carcinomas. .
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SMYD3
Q9H7B4 NM_022743 NP_073580.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 6/24/2024