Research Areas
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us


Orders Processing,
Shipping & Receiving,

2 Shaker Rd Suites
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us

Additional Contact Details

Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C747919-20 20 µl $275 
LS-C747919-100 100 µl $389 
SLC7A9 / BAT1 Antibody - Western blot analysis of extracts of various cell lines, using SLC7A9 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

Polyclonal Rabbit anti‑Human SLC7A9 / BAT1 Antibody (WB) LS‑C747919

Polyclonal Rabbit anti‑Human SLC7A9 / BAT1 Antibody (WB) LS‑C747919

SLC7A9 / BAT1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


SLC7A9 / BAT1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse
Unconjugated, Unmodified


BAT1 antibody LS-C747919 is an unconjugated rabbit polyclonal antibody to BAT1 (SLC7A9) from human. It is reactive with human and mouse. Validated for WB.
Human SLC7A9 / BAT1
SLC7A9 | BAT1 | B0,+ amino acid transporter | CSNU3 | B(0,+)AT | B0,+ AT
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1). MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL
  • Western blot (1:500 - 1:1000)
The predicted MW is 53kDa, while the observed MW by Western blot was 53kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SLC7A9 / BAT1
P82251 NM_014270 NP_055085.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 5/23/2024