Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C750423-50 50 µl $235 
LS-C750423-100 100 µl $295 
LS-C750423-200 200 µl $385 
SLC25A39 Antibody - Western blot analysis of extracts of various cell lines, using SLC25A39 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

SLC25A39 Antibody LS‑C750423

SLC25A39 Antibody LS‑C750423

Rabbit Polyclonal to Human SLC25A39
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human SLC25A39
Human, Mouse
Unconjugated, Unmodified


SLC25A39 antibody LS-C750423 is an unconjugated rabbit polyclonal antibody to SLC25A39 from human and mouse. Validated for WB.
Human SLC25A39
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:200 - 1:2000)
Recombinant fusion protein containing a sequence corresponding to amino acids 170-250 of human SLC25A39 (NP_057100.1). VISPLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPKDQTSVGMS
The predicted MW is 38kDa/39kDa, while the observed MW by Western blot was 39kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SLC25A39
Q9BZJ4 NM_016016 NP_057100.1

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 1/27/2020