Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C749984-20 20 µl $253 
LS-C749984-50 50 µl $279 
LS-C749984-100 100 µl $333 
LS-C749984-200 200 µl $429 
SEPT8 / Septin 8 Antibody - Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Polyclonal Rabbit anti‑Human SEPT8 / Septin 8 Antibody (WB) LS‑C749984

Polyclonal Rabbit anti‑Human SEPT8 / Septin 8 Antibody (WB) LS‑C749984

SEPT8 / Septin 8 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


SEPT8 / Septin 8 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


Septin 8 antibody LS-C749984 is an unconjugated rabbit polyclonal antibody to Septin 8 (SEPT8) from human. It is reactive with human, mouse and rat. Validated for WB.
Human SEPT8 / Septin 8
SEPT8 | KIAA0202 | SEP2 | Septin-8 | Septin 8
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 348-427 of human SEPT8 (NP_001287728.1). NKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKN
  • Western blot (1:500 - 1:2000)
The predicted MW is 43kDa/49kDa/51kDa/55kDa, while the observed MW by Western blot was 54kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About SEPT8 / Septin 8
Q92599 D86957 Q92599

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 5/14/2021