LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
SEPT8 / Septin 8 Antibody LS‑C749984
Septin 8 antibody LS-C749984 is an unconjugated rabbit polyclonal antibody to Septin 8 (SEPT8) from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C749984-50
50 µl
$235

Popular SEPT8 / Septin 8 Products

Anti-SEPT8 / Septin 8 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B6217 concentration 3 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Antibody
Species: Human
Applications: Western blot, ELISA
Antibody
Species: Human
Applications: Western blot, ELISA
Western blot of Septin 8 antibody
Species: Human, Mouse, Rat
Applications: Western blot, ELISA
Western blot analysis of lysates from HeLa cells, using SEPT8 Antibody. The lane on the right is blocked with the synthesized peptide.
Species: Human, Mouse, Rat
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay

Product Description

Septin 8 antibody LS-C749984 is an unconjugated rabbit polyclonal antibody to Septin 8 (SEPT8) from human, mouse and rat. Validated for WB.
About SEPT8 / Septin 8
SEPT8 / Septin 8 is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Q92599 D86957 Q92599

SEPT8 Antibody, KIAA0202 Antibody, SEP2 Antibody, Septin-8 Antibody, Septin 8 Antibody


Specifications

Target
Human SEPT8 / Septin 8
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 348-427 of human SEPT8 (NP_001287728.1). NKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKKN
Usage
The predicted MW is 43kDa/49kDa/51kDa/55kDa, while the observed MW by Western blot was 54kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Western blot

Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Western blot

Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Western blot

Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.
Western blot analysis of extracts of various cell lines, using SEPT8 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 10s.

Requested From: United States
Date Requested: 9/23/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy