Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
S1PR4 / SIP4 / EDG6 Antibody LS‑C750091
EDG6 antibody LS-C750091 is an unconjugated rabbit polyclonal antibody to human EDG6 (S1PR4 / SIP4). Validated for WB.
50 µl
EDG6 antibody LS-C750091 is an unconjugated rabbit polyclonal antibody to human EDG6 (S1PR4 / SIP4). Validated for WB.
Human S1PR4 / SIP4 / EDG6
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human S1PR4 (NP_003766.1). SAVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDSFRGSRSLSFRMREPLSSISSVRSI
The predicted MW is 41kDa, while the observed MW by Western blot was 50kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About S1PR4 / SIP4 / EDG6
O95977 NM_003775 NP_003766.1

Popular S1PR4 / SIP4 / EDG6 Products

Anti-EDG6 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human, Rat
Applications: IHC, IHC - Paraffin, ELISA
EDG6 (S1P4) monoclonal antibody (Sphingosine 1 Phosphate 4 Receptor (CT) (EDG6)) on cell lysate transfected with EDG6 (S1P4) protein at 5 ug/ml. IF on transiently transfected CHO cells. Developed with Cy5 anti-mouse, nuclei are stained with DAPI.
Species: Human
Applications: ICC, Immunofluorescence, Western blot
Immunofluorescence analysis of HepG2 cells, using EDG6 Antibody. The picture on the right is blocked with the synthesized peptide.
Species: Human, Mouse
Applications: Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Species: Human
Applications: Western blot
Anti-S1PR4 / EDG6 antibody IHC of human lymph node. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey, Dog, Pig
Applications: IHC, IHC - Paraffin

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Western blot

Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Western blot

Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Western blot

Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.
Western blot analysis of extracts of various cell lines, using S1PR4 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Requested From: United States
Date Requested: 1/16/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy